PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S04514.10
Common NameJCGZ_24140, LOC105628634
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family MYB_related
Protein Properties Length: 234aa    MW: 26992.1 Da    PI: 6.6105
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S04514.10genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding40.75.7e-13117162247
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      ++WT+eE+ l++ + + +G+g+W++I+r + k R + q+ s+ qky
    Jcr4S04514.10 117 KPWTEEEHRLFLIGLNTFGKGDWRSISRNVVKSRNPTQVASHAQKY 162
                      58*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512939.0751568IPR017884SANT domain
SMARTSM007171.1E-51667IPR001005SANT/Myb domain
SuperFamilySSF466894.35E-121873IPR009057Homeodomain-like
PROSITE profilePS5129416.674111167IPR017930Myb domain
SuperFamilySSF466891.93E-16113168IPR009057Homeodomain-like
TIGRFAMsTIGR015571.3E-14114166IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.601.0E-9115161IPR009057Homeodomain-like
SMARTSM007171.2E-9115165IPR001005SANT/Myb domain
PfamPF002497.3E-10117162IPR001005SANT/Myb domain
CDDcd001678.86E-8118163No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 234 aa     Download sequence    Send to blast
MYQDNFSTPD LTQSSPPTRW NRYEDKLFEK ALVMFPEDFP DRWQKIAEHV GRSVQEVTEH  60
YEILVHDVYE IDSGRVELPS YADEFFESSW ESPMAASNQI SFGSQTKQGD AERKKGKPWT  120
EEEHRLFLIG LNTFGKGDWR SISRNVVKSR NPTQVASHAQ KYFLRQNSVK KERKRSSIHD  180
ITTVDNNSVA PHIDKNWIAP PGGASVSVLQ EMPLASHLHD QRGSMVYQNY GFPM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A2e-1420811173RADIALIS
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012065468.11e-177PREDICTED: transcription factor DIVARICATA-like
TrEMBLA0A067L5I91e-177A0A067L5I9_JATCU; Uncharacterized protein
STRINGGLYMA20G24600.11e-100(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF60683251
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04760.13e-81MYB family protein
Publications ? help Back to Top
  1. Zhang L, et al.
    Global analysis of gene expression profiles in physic nut (Jatropha curcas L.) seedlings exposed to salt stress.
    PLoS ONE, 2014. 9(5): p. e97878
    [PMID:24837971]